$0.00
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Block Huggers Clothing Shiny Bubble
Block Huggers Clothing Shiny Bubble
Block Huggers Clothing Shiny Bubble
$400.00 inc. tax
Block Huggers Clothing co Shiny Bubble coat. Coats come with a choice of a black, baby blue, green, red and yellow. Block Huggers Clothing Logo on the chest and on the back available in shiny black from S to 3X. Be specific if you want a patch color combination that is not shown. Dry Cleaning recommended.
View Gallery
View Gallery
Buy
  • Buy
  • Product Details
    • Notify me when product is back in stock
    Block Huggers Clothing Shiny Bubble
    $400.00 inc. tax
    Options
    Size
    Embroidered Patch Color
    Buy
    Add to Cart
    Product Code: NUwZRFW
    Product Condition: New
    Product Added to your Cart
    x

    -------- OR --------

    Create a free online store
    Powered by freewebstore
    Get your free online store today - Be your own boss!
    freewebstore
    Got a great business idea?
    Get a free online store just like this one!
    What do I get?
    Full eCommerce store
    Free hosting
    Unlimited products
    Domain & Free SSL
    checkout
    24/7 support
    And more...
    Why freewebstore?
    20+ years
    1M+ stores created
    No payment required
    Easy to create
    What's the catch?
    Nope, no catch
    0% commission
    Free forever!
    Premium upgrades available
    Get Started
    i