Product Added to your Cart
x

-------- OR --------

$0.00
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL

Songs

2 product(s) found for "Songs"
“Only 4 Money” Kaptin K Offi..
Block Huggers Records presents Only 4 Money Kaptin K produced by BullyOnDaBeat official video shot by DJ Inhuman Video available to stream on YouTube or you can purchase digital copies directly from us.
Details
“Only 4 Money” Kaptin K Offi..
Block Huggers Records “The B..
Block Huggers Records presents The Bag Chasin Monsters EP featuring tracks by Onnarise Baby Jay x Kaptin K x StunnaBaby Freak G x BHB Blizz Mucho x and BUB Bobby Balenciaga hosted by DJ Nino
Details
Block Huggers Records “The B..
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i