$0.00
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Toxic Kaptin K feat Michael-Jamal produced by Kevin Lamar
Toxic Kaptin K feat Michael-Jamal produced by Kevin Lamar
Toxic Kaptin K feat Michael-Jamal produced by Kevin Lamar
$1.00 inc. tax
Block Huggers Records
"Toxic"
Kaptin K feat. Michael-Jamal
Produced by Kevin Lamar

Hard copies available for purchase include the regular version and the chopped and screwed version by Nigel Crown

Or stream or purchase the original version digitally

https://distrokid.com/hyperfollow/kaptink/toxic-feat-michael-jamal
Buy
  • Buy
  • Product Details
    • Notify me when product is back in stock
    Toxic Kaptin K feat Michael-Jamal produced by Kevin Lamar
    $1.00 inc. tax
    Buy
    Add to Cart
    Product Code: ctfYRJq
    Product Condition: New
    Product Added to your Cart
    x

    -------- OR --------

    Create a free online store
    Powered by freewebstore
    Get your free online store today - Be your own boss!
    freewebstore
    Got a great business idea?
    Get a free online store just like this one!
    What do I get?
    Full eCommerce store
    Free hosting
    Unlimited products
    Domain & Free SSL
    checkout
    24/7 support
    And more...
    Why freewebstore?
    20+ years
    1M+ stores created
    No payment required
    Easy to create
    What's the catch?
    Nope, no catch
    0% commission
    Free forever!
    Premium upgrades available
    Get Started
    i