$0.00
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
“Blues” Kaptin K produced by Anti
“Blues” Kaptin K produced by Anti
“Blues” Kaptin K produced by Anti
$1.00 inc. tax

https://music.apple.com/us/album/blues/1722901806?i=1722901807

Block Huggers Records presents “Blues” Kaptin K produced by Anti 

Available as a single on most major platforms such as Apple Music, Amazon Music, Spotify and more.

Currently only available digitally. Vinyl and CDs coming soon.

Buy
  • Buy
  • Product Details
    • “Blues” Kaptin K produced by Anti
    $1.00 inc. tax
    Buy
    Add to Cart
    Product Code: v9d8AL2
    Product Condition: New
    Product Added to your Cart
    x

    -------- OR --------

    Create a free online store
    Powered by freewebstore
    Get your free online store today - Be your own boss!
    freewebstore
    Got a great business idea?
    Get a free online store just like this one!
    What do I get?
    Full eCommerce store
    Free hosting
    Unlimited products
    Domain & Free SSL
    checkout
    24/7 support
    And more...
    Why freewebstore?
    20+ years
    1M+ stores created
    No payment required
    Easy to create
    What's the catch?
    Nope, no catch
    0% commission
    Free forever!
    Premium upgrades available
    Get Started
    i