$0.00
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Block Huggers Clothing Bag Chasing Monster Tee White and Sky Blue
Block Huggers Clothing Bag Chasing Monster Tee White and Sky Blue
Block Huggers Clothing Bag Chasing Monster Tee White and Sky Blue
$25.00 inc. tax
Block Huggers Clothing Co Bag Chasing Monster logo Tee. White with the sky blue background. Sizes small to 3XL
View Gallery
View Gallery
Buy
  • Buy
  • Product Details
    • Notify me when product is back in stock
    Block Huggers Clothing Bag Chasing Monster Tee White and Sky Blue
    $25.00 inc. tax
    Options
    Size
    Buy
    Add to Cart
    Product Code: KMev2Ef
    Product Condition: New
    Product Added to your Cart
    x

    -------- OR --------

    Create a free online store
    Powered by freewebstore
    Get your free online store today - Be your own boss!
    freewebstore
    Got a great business idea?
    Get a free online store just like this one!
    What do I get?
    Full eCommerce store
    Free hosting
    Unlimited products
    Domain & Free SSL
    checkout
    24/7 support
    And more...
    Why freewebstore?
    20+ years
    1M+ stores created
    No payment required
    Easy to create
    What's the catch?
    Nope, no catch
    0% commission
    Free forever!
    Premium upgrades available
    Get Started
    i