$0.00
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
“Road Blocks” Kaptin K produced by KenyaanOnDaBeat shot by DJ Inhuman
“Road Blocks” Kaptin K produced by KenyaanOnDaBeat shot by DJ Inhuman
“Road Blocks” Kaptin K produced by KenyaanOnDaBeat shot by DJ Inhuman
$5.00 inc. tax

https://youtu.be/TuIvmTMRg98?feature=shared

Block Huggers Records presents “Road Blocks” Kaptin K produced by KenyaanOnDaBeat Official video shot by DJ Inhuman

Watch for free on YouTube or purchase your own digital copy sent directly to your email

Buy
  • Buy
  • Product Details
    • “Road Blocks” Kaptin K produced by KenyaanOnDaBeat shot by DJ Inhuman
    $5.00 inc. tax
    Buy
    Add to Cart
    Product Code: wcESaSv
    Product Condition: New
    Product Added to your Cart
    x

    -------- OR --------

    Create a free online store
    Powered by freewebstore
    Get your free online store today - Be your own boss!
    freewebstore
    Got a great business idea?
    Get a free online store just like this one!
    What do I get?
    Full eCommerce store
    Free hosting
    Unlimited products
    Domain & Free SSL
    checkout
    24/7 support
    And more...
    Why freewebstore?
    20+ years
    1M+ stores created
    No payment required
    Easy to create
    What's the catch?
    Nope, no catch
    0% commission
    Free forever!
    Premium upgrades available
    Get Started
    i